Placeholder image of a protein
Icon representing a puzzle

1384: Solved Foldit Design: Electron Density

Closed since almost 9 years ago

Intermediate Overall Prediction Electron Density

Summary

Created
May 30, 2017
Expires
Max points
100
Description

This puzzle features a protein designed from scratch by Foldit players! In Puzzle 1381 we asked players to try to predict the structure of this protein from the sequence alone. We have since solved the crystal structure of this protein, and here we are providing players with the refined electron density map. See the blog for more details. Players can load in solutions from Puzzle 1381 to see how their predictions fit in the electron density map, and players can try building into the electron density from an extended chain!



Sequence:


TELEKHREELKEFLKKEGITNVEIRIDNGRLEVRVEGGTERLKRFLEELRQKLEKKGYTVDIKIE

Top groups

  1. Avatar for Russian team 11. Russian team 2 pts. 9,530
  2. Avatar for xkcd 12. xkcd 1 pt. 9,208
  3. Avatar for Natural Abilities 13. Natural Abilities 1 pt. 9,036
  4. Avatar for Piratenpartei Deutschland 14. Piratenpartei Deutschland 1 pt. 8,850
  5. Avatar for Richard Dawkins Foundation 15. Richard Dawkins Foundation 1 pt. 8,327
  6. Avatar for SETI.Germany 16. SETI.Germany 1 pt. 8,105
  7. Avatar for SHELL 17. SHELL 1 pt. 7,807
  8. Avatar for Window Group 18. Window Group 1 pt. 3,071
  1. Avatar for Skippysk8s 21. Skippysk8s Lv 1 51 pts. 11,692
  2. Avatar for retiredmichael 22. retiredmichael Lv 1 50 pts. 11,692
  3. Avatar for ZeroLeak7 23. ZeroLeak7 Lv 1 48 pts. 11,691
  4. Avatar for isaksson 24. isaksson Lv 1 46 pts. 11,690
  5. Avatar for pauldunn 25. pauldunn Lv 1 44 pts. 11,688
  6. Avatar for Bruno Kestemont 26. Bruno Kestemont Lv 1 43 pts. 11,685
  7. Avatar for guineapig 27. guineapig Lv 1 41 pts. 11,675
  8. Avatar for jermainiac 28. jermainiac Lv 1 40 pts. 11,659
  9. Avatar for kabubi 29. kabubi Lv 1 38 pts. 11,625
  10. Avatar for Bautho 30. Bautho Lv 1 37 pts. 11,599

Comments

bkoep Staff Lv 1

Hmm, that's strange. In the full electron density map, all of the residues (and most of the sidechains) are well resolved. Something must have happened when we trimmed the density map for the Foldit puzzle. I'm sorry we didn't catch that before posting the puzzle!