Placeholder image of a protein
Icon representing a puzzle

1384: Solved Foldit Design: Electron Density

Closed since almost 9 years ago

Intermediate Overall Prediction Electron Density

Summary


Created
May 30, 2017
Expires
Max points
100
Description

This puzzle features a protein designed from scratch by Foldit players! In Puzzle 1381 we asked players to try to predict the structure of this protein from the sequence alone. We have since solved the crystal structure of this protein, and here we are providing players with the refined electron density map. See the blog for more details. Players can load in solutions from Puzzle 1381 to see how their predictions fit in the electron density map, and players can try building into the electron density from an extended chain!



Sequence:


TELEKHREELKEFLKKEGITNVEIRIDNGRLEVRVEGGTERLKRFLEELRQKLEKKGYTVDIKIE

Top groups


  1. Avatar for Russian team 11. Russian team 2 pts. 9,530
  2. Avatar for xkcd 12. xkcd 1 pt. 9,208
  3. Avatar for Natural Abilities 13. Natural Abilities 1 pt. 9,036
  4. Avatar for SETI.Germany 16. SETI.Germany 1 pt. 8,105
  5. Avatar for SHELL 17. SHELL 1 pt. 7,807
  6. Avatar for Window Group 18. Window Group 1 pt. 3,071

  1. Avatar for Anfinsen_slept_here 31. Anfinsen_slept_here Lv 1 35 pts. 11,556
  2. Avatar for NinjaGreg 32. NinjaGreg Lv 1 34 pts. 11,186
  3. Avatar for pvc78 33. pvc78 Lv 1 33 pts. 11,154
  4. Avatar for mimi 34. mimi Lv 1 31 pts. 11,031
  5. Avatar for crpainter 35. crpainter Lv 1 30 pts. 10,986
  6. Avatar for Keresto 36. Keresto Lv 1 29 pts. 10,775
  7. Avatar for Vinara 37. Vinara Lv 1 28 pts. 10,769
  8. Avatar for dssb 38. dssb Lv 1 27 pts. 10,732
  9. Avatar for phi16 39. phi16 Lv 1 26 pts. 10,712
  10. Avatar for katling 40. katling Lv 1 25 pts. 10,678

Comments


bkoep Staff Lv 1

Hmm, that's strange. In the full electron density map, all of the residues (and most of the sidechains) are well resolved. Something must have happened when we trimmed the density map for the Foldit puzzle. I'm sorry we didn't catch that before posting the puzzle!