Placeholder image of a protein
Icon representing a puzzle

1384: Solved Foldit Design: Electron Density

Closed since almost 9 years ago

Intermediate Overall Prediction Electron Density

Summary

Created
May 30, 2017
Expires
Max points
100
Description

This puzzle features a protein designed from scratch by Foldit players! In Puzzle 1381 we asked players to try to predict the structure of this protein from the sequence alone. We have since solved the crystal structure of this protein, and here we are providing players with the refined electron density map. See the blog for more details. Players can load in solutions from Puzzle 1381 to see how their predictions fit in the electron density map, and players can try building into the electron density from an extended chain!



Sequence:


TELEKHREELKEFLKKEGITNVEIRIDNGRLEVRVEGGTERLKRFLEELRQKLEKKGYTVDIKIE

Top groups

  1. Avatar for Russian team 11. Russian team 2 pts. 9,530
  2. Avatar for xkcd 12. xkcd 1 pt. 9,208
  3. Avatar for Natural Abilities 13. Natural Abilities 1 pt. 9,036
  4. Avatar for Piratenpartei Deutschland 14. Piratenpartei Deutschland 1 pt. 8,850
  5. Avatar for Richard Dawkins Foundation 15. Richard Dawkins Foundation 1 pt. 8,327
  6. Avatar for SETI.Germany 16. SETI.Germany 1 pt. 8,105
  7. Avatar for SHELL 17. SHELL 1 pt. 7,807
  8. Avatar for Window Group 18. Window Group 1 pt. 3,071
  1. Avatar for georg137 71. georg137 Lv 1 6 pts. 9,246
  2. Avatar for diamonddays 72. diamonddays Lv 1 6 pts. 9,235
  3. Avatar for Soggy Doglog 73. Soggy Doglog Lv 1 5 pts. 9,221
  4. Avatar for fryguy 74. fryguy Lv 1 5 pts. 9,208
  5. Avatar for toshiue 75. toshiue Lv 1 5 pts. 9,200
  6. Avatar for rabamino12358 76. rabamino12358 Lv 1 5 pts. 9,198
  7. Avatar for bcre8tvv 77. bcre8tvv Lv 1 4 pts. 9,189
  8. Avatar for SKSbell 78. SKSbell Lv 1 4 pts. 9,152
  9. Avatar for froggs554 79. froggs554 Lv 1 4 pts. 9,150
  10. Avatar for firejuggler 80. firejuggler Lv 1 4 pts. 9,145

Comments

bkoep Staff Lv 1

Hmm, that's strange. In the full electron density map, all of the residues (and most of the sidechains) are well resolved. Something must have happened when we trimmed the density map for the Foldit puzzle. I'm sorry we didn't catch that before posting the puzzle!