Placeholder image of a protein
Icon representing a puzzle

1384: Solved Foldit Design: Electron Density

Closed since almost 9 years ago

Intermediate Overall Prediction Electron Density

Summary

Created
May 30, 2017
Expires
Max points
100
Description

This puzzle features a protein designed from scratch by Foldit players! In Puzzle 1381 we asked players to try to predict the structure of this protein from the sequence alone. We have since solved the crystal structure of this protein, and here we are providing players with the refined electron density map. See the blog for more details. Players can load in solutions from Puzzle 1381 to see how their predictions fit in the electron density map, and players can try building into the electron density from an extended chain!



Sequence:


TELEKHREELKEFLKKEGITNVEIRIDNGRLEVRVEGGTERLKRFLEELRQKLEKKGYTVDIKIE

Top groups

  1. Avatar for Russian team 11. Russian team 2 pts. 9,530
  2. Avatar for xkcd 12. xkcd 1 pt. 9,208
  3. Avatar for Natural Abilities 13. Natural Abilities 1 pt. 9,036
  4. Avatar for Piratenpartei Deutschland 14. Piratenpartei Deutschland 1 pt. 8,850
  5. Avatar for Richard Dawkins Foundation 15. Richard Dawkins Foundation 1 pt. 8,327
  6. Avatar for SETI.Germany 16. SETI.Germany 1 pt. 8,105
  7. Avatar for SHELL 17. SHELL 1 pt. 7,807
  8. Avatar for Window Group 18. Window Group 1 pt. 3,071
  1. Avatar for Deleted player 81. Deleted player pts. 9,132
  2. Avatar for dizzywings 82. dizzywings Lv 1 3 pts. 9,114
  3. Avatar for alcor29 83. alcor29 Lv 1 3 pts. 9,094
  4. Avatar for stomjoh 84. stomjoh Lv 1 3 pts. 9,063
  5. Avatar for Alistair69 85. Alistair69 Lv 1 3 pts. 9,057
  6. Avatar for Merf 86. Merf Lv 1 3 pts. 9,052
  7. Avatar for Mr_Jolty 87. Mr_Jolty Lv 1 2 pts. 9,036
  8. Avatar for ViJay7019 88. ViJay7019 Lv 1 2 pts. 9,034
  9. Avatar for smholst 89. smholst Lv 1 2 pts. 9,005
  10. Avatar for manu8170 90. manu8170 Lv 1 2 pts. 8,980

Comments

bkoep Staff Lv 1

Hmm, that's strange. In the full electron density map, all of the residues (and most of the sidechains) are well resolved. Something must have happened when we trimmed the density map for the Foldit puzzle. I'm sorry we didn't catch that before posting the puzzle!