Placeholder image of a protein
Icon representing a puzzle

1384: Solved Foldit Design: Electron Density

Closed since almost 9 years ago

Intermediate Intermediate Overall Overall Prediction Prediction Electron Density Electron Density

Summary


Created
May 30, 2017
Expires
Max points
100
Description

This puzzle features a protein designed from scratch by Foldit players! In Puzzle 1381 we asked players to try to predict the structure of this protein from the sequence alone. We have since solved the crystal structure of this protein, and here we are providing players with the refined electron density map. See the blog for more details. Players can load in solutions from Puzzle 1381 to see how their predictions fit in the electron density map, and players can try building into the electron density from an extended chain!



Sequence:


TELEKHREELKEFLKKEGITNVEIRIDNGRLEVRVEGGTERLKRFLEELRQKLEKKGYTVDIKIE

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,718
  2. Avatar for Gargleblasters 2. Gargleblasters 74 pts. 11,711
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 11,709
  4. Avatar for Contenders 4. Contenders 38 pts. 11,709
  5. Avatar for Go Science 5. Go Science 27 pts. 11,706
  6. Avatar for Void Crushers 6. Void Crushers 18 pts. 11,700
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 12 pts. 10,567
  8. Avatar for freefolder 8. freefolder 8 pts. 10,154
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 5 pts. 9,699
  10. Avatar for HMT heritage 10. HMT heritage 3 pts. 9,607

  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 11,718
  2. Avatar for markm457 2. markm457 Lv 1 97 pts. 11,717
  3. Avatar for tokens 3. tokens Lv 1 94 pts. 11,711
  4. Avatar for anthion 4. anthion Lv 1 91 pts. 11,710
  5. Avatar for gitwut 5. gitwut Lv 1 88 pts. 11,708
  6. Avatar for MurloW 6. MurloW Lv 1 86 pts. 11,707
  7. Avatar for Susume 7. Susume Lv 1 83 pts. 11,706
  8. Avatar for Wilm 8. Wilm Lv 1 80 pts. 11,704
  9. Avatar for dcrwheeler 9. dcrwheeler Lv 1 78 pts. 11,703
  10. Avatar for eusair 10. eusair Lv 1 75 pts. 11,702

Comments


bkoep Staff Lv 1

Hmm, that's strange. In the full electron density map, all of the residues (and most of the sidechains) are well resolved. Something must have happened when we trimmed the density map for the Foldit puzzle. I'm sorry we didn't catch that before posting the puzzle!