Placeholder image of a protein
Icon representing a puzzle

1384: Solved Foldit Design: Electron Density

Closed since almost 9 years ago

Intermediate Intermediate Overall Overall Prediction Prediction Electron Density Electron Density

Summary


Created
May 30, 2017
Expires
Max points
100
Description

This puzzle features a protein designed from scratch by Foldit players! In Puzzle 1381 we asked players to try to predict the structure of this protein from the sequence alone. We have since solved the crystal structure of this protein, and here we are providing players with the refined electron density map. See the blog for more details. Players can load in solutions from Puzzle 1381 to see how their predictions fit in the electron density map, and players can try building into the electron density from an extended chain!



Sequence:


TELEKHREELKEFLKKEGITNVEIRIDNGRLEVRVEGGTERLKRFLEELRQKLEKKGYTVDIKIE

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,718
  2. Avatar for Gargleblasters 2. Gargleblasters 74 pts. 11,711
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 11,709
  4. Avatar for Contenders 4. Contenders 38 pts. 11,709
  5. Avatar for Go Science 5. Go Science 27 pts. 11,706
  6. Avatar for Void Crushers 6. Void Crushers 18 pts. 11,700
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 12 pts. 10,567
  8. Avatar for freefolder 8. freefolder 8 pts. 10,154
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 5 pts. 9,699
  10. Avatar for HMT heritage 10. HMT heritage 3 pts. 9,607

  1. Avatar for we646410766 141. we646410766 Lv 1 1 pt. 5,574
  2. Avatar for larry25427 142. larry25427 Lv 1 1 pt. 5,477
  3. Avatar for 01010011111 143. 01010011111 Lv 1 1 pt. 5,153
  4. Avatar for star7777777 144. star7777777 Lv 1 1 pt. 5,111
  5. Avatar for bez.cerny 145. bez.cerny Lv 1 1 pt. 3,480
  6. Avatar for jflat06 146. jflat06 Lv 1 1 pt. 3,071
  7. Avatar for boboviz 147. boboviz Lv 1 1 pt. 0
  8. Avatar for fishercat 149. fishercat Lv 1 1 pt. 0
  9. Avatar for spvincent 150. spvincent Lv 1 1 pt. 0

Comments


Wilm Lv 1

Just for (fun) reference, can you give us the resolution of the ED?

bkoep Staff Lv 1

I know you've shared solutions for this crash on previous puzzles—if you also have a solution that crashes reproducibly on this puzzle and can Share with Scientists, that would be still helpful.

Or does Foldit crash when wiggling the start structure, immediately after opening the puzzle?

Wilm Lv 1

Thanks. The number is a bit surprising to me if I compare that with the resolution of the previous puzzle 1357 at 1.5A. Puzzle 1384 has quite a few stretches of the protein that don't show up at all. I guess it makes sense if it is the maximum resolution this number is referring to…
So, if I read in a paper "the structure of protein x has been determined at 1.5A resolution" what does that mean exactly? On average 1.5A? Maximum of 1.5A? 1.5A except in variable regions? I know it is probably a bit pedantic, I just haven't thought about this much before Foldit ED puzzles.

pauldunn Lv 1

It will crash when wiggling the start structure, immediately after opening the puzzle. Let me know if I can provide any more information.

bkoep Staff Lv 1

Good question! When we talk about resolution limits in x-ray crystallography, we're talking specifically about the extent of x-ray diffraction (see the blog for more on diffraction). With respect to the electron density map, the resolution limit is just that—a limit. A resolution limit of 1.5 Å means roughly that the raw data contain no information about positions closer than 1.5 Å.

Other effects can "blur" portions of the refined electron density map—mostly having to do with ambiguous atom placement (e.g. thermal motion, partial occupancy, disordered regions).

kabubi Lv 1

resolution of this puzzle appears lower than others to me.
i hardly recognize few residue.
It has been already trimmed?

Susume Lv 1

It seems odd to see a cloud with very clear outlines for interior atoms and no cloud whatsoever for whole residues (not just sidechains) at the protein surface. I can imagine the many long blue sidechains on the surface of a foldit design being floppy and maybe not having cloud, but I would not expect the very short loops in this protein to be disordered, would you? The complete lack of cloud for a tyrosine is also surprising. What is going on?

Susume Lv 1

Another note - moving the threshold slider to the left usually shows more and more cloud, but in this puzzle a threshold of 0 shows the same as having it at a quarter of the slider - it's like the less-certain part of the cloud has been completely omitted.