Placeholder image of a protein
Icon representing a puzzle

1385: Revisiting Puzzle 113: White Birch

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary


Created
May 31, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups


  1. Avatar for Russian team 11. Russian team 1 pt. 9,151
  2. Avatar for xkcd 12. xkcd 1 pt. 9,043
  3. Avatar for Natural Abilities 13. Natural Abilities 1 pt. 9,028

  1. Avatar for retiredmichael
    1. retiredmichael Lv 1
    100 pts. 9,571
  2. Avatar for LociOiling 2. LociOiling Lv 1 97 pts. 9,565
  3. Avatar for Galaxie 3. Galaxie Lv 1 94 pts. 9,551
  4. Avatar for gmn 4. gmn Lv 1 91 pts. 9,543
  5. Avatar for ZeroLeak7 5. ZeroLeak7 Lv 1 88 pts. 9,542
  6. Avatar for Bletchley Park 6. Bletchley Park Lv 1 85 pts. 9,534
  7. Avatar for bertro 7. bertro Lv 1 82 pts. 9,524
  8. Avatar for markm457 8. markm457 Lv 1 79 pts. 9,524
  9. Avatar for randomlil 9. randomlil Lv 1 76 pts. 9,519
  10. Avatar for tokens 10. tokens Lv 1 73 pts. 9,518

Comments