Placeholder image of a protein
Icon representing a puzzle

1385: Revisiting Puzzle 113: White Birch

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
May 31, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,582
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 68 pts. 9,553
  3. Avatar for Go Science 3. Go Science 44 pts. 9,542
  4. Avatar for Contenders 4. Contenders 27 pts. 9,541
  5. Avatar for HMT heritage 5. HMT heritage 16 pts. 9,496
  6. Avatar for Gargleblasters 6. Gargleblasters 9 pts. 9,485
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 5 pts. 9,462
  8. Avatar for Void Crushers 8. Void Crushers 3 pts. 9,400
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 1 pt. 9,356
  10. Avatar for freefolder 10. freefolder 1 pt. 9,199
  1. Avatar for ManVsYard 21. ManVsYard Lv 1 1 pt. 9,481
  2. Avatar for lupussapien 22. lupussapien Lv 1 1 pt. 9,480
  3. Avatar for gitwut 23. gitwut Lv 1 1 pt. 9,439
  4. Avatar for alcor29 24. alcor29 Lv 1 1 pt. 9,434
  5. Avatar for smholst 25. smholst Lv 1 1 pt. 9,420
  6. Avatar for anthion 26. anthion Lv 1 1 pt. 9,345

Comments