Placeholder image of a protein
Icon representing a puzzle

1385: Revisiting Puzzle 113: White Birch

Closed since almost 9 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
May 31, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups


  1. Avatar for Beta Folders 100 pts. 9,582
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 68 pts. 9,553
  3. Avatar for Go Science 3. Go Science 44 pts. 9,542
  4. Avatar for Contenders 4. Contenders 27 pts. 9,541
  5. Avatar for HMT heritage 5. HMT heritage 16 pts. 9,496
  6. Avatar for Gargleblasters 6. Gargleblasters 9 pts. 9,485
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 5 pts. 9,462
  8. Avatar for Void Crushers 8. Void Crushers 3 pts. 9,400
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 1 pt. 9,356
  10. Avatar for freefolder 10. freefolder 1 pt. 9,199

  1. Avatar for stomjoh 21. stomjoh Lv 1 49 pts. 9,460
  2. Avatar for pauldunn 22. pauldunn Lv 1 47 pts. 9,460
  3. Avatar for dcrwheeler 23. dcrwheeler Lv 1 45 pts. 9,459
  4. Avatar for phi16 24. phi16 Lv 1 43 pts. 9,451
  5. Avatar for johnmitch 25. johnmitch Lv 1 42 pts. 9,450
  6. Avatar for nicobul 26. nicobul Lv 1 40 pts. 9,441
  7. Avatar for frood66 27. frood66 Lv 1 38 pts. 9,439
  8. Avatar for crpainter 28. crpainter Lv 1 37 pts. 9,438
  9. Avatar for reefyrob 29. reefyrob Lv 1 35 pts. 9,435
  10. Avatar for tony46 30. tony46 Lv 1 34 pts. 9,429

Comments