Placeholder image of a protein
Icon representing a puzzle

1385: Revisiting Puzzle 113: White Birch

Closed since almost 9 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
May 31, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups


  1. Avatar for Beta Folders 100 pts. 9,582
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 68 pts. 9,553
  3. Avatar for Go Science 3. Go Science 44 pts. 9,542
  4. Avatar for Contenders 4. Contenders 27 pts. 9,541
  5. Avatar for HMT heritage 5. HMT heritage 16 pts. 9,496
  6. Avatar for Gargleblasters 6. Gargleblasters 9 pts. 9,485
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 5 pts. 9,462
  8. Avatar for Void Crushers 8. Void Crushers 3 pts. 9,400
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 1 pt. 9,356
  10. Avatar for freefolder 10. freefolder 1 pt. 9,199

  1. Avatar for katling 31. katling Lv 1 32 pts. 9,427
  2. Avatar for jobo0502 32. jobo0502 Lv 1 31 pts. 9,425
  3. Avatar for christioanchauvin 33. christioanchauvin Lv 1 30 pts. 9,403
  4. Avatar for kabubi 34. kabubi Lv 1 29 pts. 9,400
  5. Avatar for anthion 35. anthion Lv 1 27 pts. 9,393
  6. Avatar for alcor29 36. alcor29 Lv 1 26 pts. 9,390
  7. Avatar for guineapig 37. guineapig Lv 1 25 pts. 9,386
  8. Avatar for NinjaGreg 38. NinjaGreg Lv 1 24 pts. 9,377
  9. Avatar for pvc78 39. pvc78 Lv 1 23 pts. 9,370
  10. Avatar for tarimo 40. tarimo Lv 1 22 pts. 9,368

Comments