Placeholder image of a protein
Icon representing a puzzle

1385: Revisiting Puzzle 113: White Birch

Closed since almost 9 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
May 31, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups


  1. Avatar for Beta Folders 100 pts. 9,582
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 68 pts. 9,553
  3. Avatar for Go Science 3. Go Science 44 pts. 9,542
  4. Avatar for Contenders 4. Contenders 27 pts. 9,541
  5. Avatar for HMT heritage 5. HMT heritage 16 pts. 9,496
  6. Avatar for Gargleblasters 6. Gargleblasters 9 pts. 9,485
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 5 pts. 9,462
  8. Avatar for Void Crushers 8. Void Crushers 3 pts. 9,400
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 1 pt. 9,356
  10. Avatar for freefolder 10. freefolder 1 pt. 9,199

  1. Avatar for jinhd6 141. jinhd6 Lv 1 1 pt. 8,396
  2. Avatar for DipsyDoodle2016 142. DipsyDoodle2016 Lv 1 1 pt. 8,349
  3. Avatar for emdee314 143. emdee314 Lv 1 1 pt. 8,319
  4. Avatar for Uttkarsh 144. Uttkarsh Lv 1 1 pt. 8,225
  5. Avatar for zhoulvyylj 145. zhoulvyylj Lv 1 1 pt. 8,213
  6. Avatar for 01010011111 146. 01010011111 Lv 1 1 pt. 7,579
  7. Avatar for DoctorSockrates 147. DoctorSockrates Lv 1 1 pt. 5,788
  8. Avatar for rachel580 148. rachel580 Lv 1 1 pt. 5,788

Comments