Placeholder image of a protein
Icon representing a puzzle

1390: Dysferlin Linker Domain: Rosetta Model

Closed since almost 9 years ago

Intermediate Overall Prediction Predicted Contacts

Summary


Created
June 13, 2017
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzles 1369 and 1372. Here we've provided the top Rosetta prediction as the starting structure. Note that predicted contacts are still available, and can be accessed from the Main menu (Selection Interface) or in the Actions tab (Classic Interface). Players may load in manual saves from Puzzles 1369 and 1372 and use them as a starting point here.



This is a domain of the human dysferlin protein. Dysferlin is found in muscle cells and associates with the cell membrane, although its exact function is unknown. Mutations in the dysferlin gene can cause a debilitating type of muscular dystrophy. See the blog for more info. Our collaborators at the Jain Foundation would like to model the structure of dysferlin to better understand its function, and have asked Foldit players to help! Players may recall folding the C2B calcium-binding domain of dysferlin in Puzzles 1291 and 1293b. The residues modeled in this puzzle link two calcium-binding domains in dysferlin. It is unclear whether this domain serves a particular function, but some experimental data suggests it is well-folded.



Sequence:


PQTYCVSGPNQWRDQLRPSQLLHLFCQQHRVKAPVYRTDRVMFQDKEYSIEEIEAGRIPNPHLGPVEERLALHVLQQQGLVPEHVESRPLYSPLQPDIE

Top groups


  1. Avatar for xkcd 11. xkcd 1 pt. 10,482
  2. Avatar for HMT heritage 12. HMT heritage 1 pt. 10,390
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 1 pt. 10,380
  4. Avatar for Russian team 14. Russian team 1 pt. 10,366
  5. Avatar for Eὕρηκα! Heureka! 15. Eὕρηκα! Heureka! 1 pt. 10,146

  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 11,251
  2. Avatar for lamoille 2. lamoille Lv 1 82 pts. 11,246
  3. Avatar for Deleted player 3. Deleted player pts. 11,240
  4. Avatar for smilingone 4. smilingone Lv 1 53 pts. 11,231
  5. Avatar for LociOiling 5. LociOiling Lv 1 42 pts. 11,230
  6. Avatar for reefyrob 6. reefyrob Lv 1 33 pts. 11,226
  7. Avatar for alwen 7. alwen Lv 1 26 pts. 11,137
  8. Avatar for jamiexq 8. jamiexq Lv 1 20 pts. 11,092
  9. Avatar for Bruno Kestemont 9. Bruno Kestemont Lv 1 15 pts. 10,971
  10. Avatar for Hollinas 10. Hollinas Lv 1 11 pts. 10,971

Comments