Placeholder image of a protein
Icon representing a puzzle

1391: Revisiting Puzzle 115: Exocyst

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
June 15, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups

  1. Avatar for Richard Dawkins Foundation 11. Richard Dawkins Foundation 1 pt. 9,051
  2. Avatar for xkcd 12. xkcd 1 pt. 8,982
  3. Avatar for Natural Abilities 13. Natural Abilities 1 pt. 8,982
  4. Avatar for IEGS Biochemistry 14. IEGS Biochemistry 1 pt. 8,605
  5. Avatar for GUGITBIOTECH 15. GUGITBIOTECH 1 pt. 7,913
  6. Avatar for Window Group 16. Window Group 1 pt. 6,662
  1. Avatar for dcrwheeler
    1. dcrwheeler Lv 1
    100 pts. 9,630
  2. Avatar for markm457 2. markm457 Lv 1 97 pts. 9,613
  3. Avatar for Timo van der Laan 3. Timo van der Laan Lv 1 94 pts. 9,609
  4. Avatar for Bruno Kestemont 4. Bruno Kestemont Lv 1 90 pts. 9,607
  5. Avatar for Blipperman 5. Blipperman Lv 1 87 pts. 9,602
  6. Avatar for bertro 6. bertro Lv 1 84 pts. 9,595
  7. Avatar for Bletchley Park 7. Bletchley Park Lv 1 81 pts. 9,583
  8. Avatar for Deleted player 8. Deleted player pts. 9,577
  9. Avatar for LociOiling 9. LociOiling Lv 1 75 pts. 9,571
  10. Avatar for johnmitch 10. johnmitch Lv 1 73 pts. 9,571

Comments