Placeholder image of a protein
Icon representing a puzzle

1391: Revisiting Puzzle 115: Exocyst

Closed since almost 9 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
June 15, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups


  1. Avatar for xkcd 12. xkcd 1 pt. 8,982
  2. Avatar for Natural Abilities 13. Natural Abilities 1 pt. 8,982
  3. Avatar for IEGS Biochemistry 14. IEGS Biochemistry 1 pt. 8,605
  4. Avatar for GUGITBIOTECH 15. GUGITBIOTECH 1 pt. 7,913
  5. Avatar for Window Group 16. Window Group 1 pt. 6,662

  1. Avatar for Blipperman
    1. Blipperman Lv 1
    100 pts. 9,615
  2. Avatar for actiasluna 2. actiasluna Lv 1 81 pts. 9,614
  3. Avatar for Skippysk8s 3. Skippysk8s Lv 1 65 pts. 9,613
  4. Avatar for Galaxie 4. Galaxie Lv 1 52 pts. 9,611
  5. Avatar for Deleted player 5. Deleted player pts. 9,610
  6. Avatar for toshiue 6. toshiue Lv 1 32 pts. 9,608
  7. Avatar for kabubi 7. kabubi Lv 1 24 pts. 9,605
  8. Avatar for phi16 8. phi16 Lv 1 18 pts. 9,604
  9. Avatar for smilingone 9. smilingone Lv 1 14 pts. 9,596
  10. Avatar for LociOiling 10. LociOiling Lv 1 10 pts. 9,596

Comments