1391: Revisiting Puzzle 115: Exocyst

Closed since over 8 years ago

Summary

• Created: June 15, 2017
• Expires: June 22, 2017 at 18:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups

• 1. Gargleblasters 100 pts. 9,615
• 2. Anthropic Dreams 71 pts. 9,613
• 3. Void Crushers 49 pts. 9,609
• 4. Go Science 33 pts. 9,608
• 5. Beta Folders 22 pts. 9,596
• 6. Contenders 14 pts. 9,583
• 7. L'Alliance Francophone 8 pts. 9,456
• 8. HMT heritage 5 pts. 9,387
• 9. Marvin's bunch 3 pts. 9,351
• 10. Italiani Al Lavoro 2 pts. 9,290

Top evolvers

• 1. Blipperman 100 pts. 9,615
• 2. actiasluna 81 pts. 9,614
• 3. Skippysk8s 65 pts. 9,613
• 4. Galaxie 52 pts. 9,611
• 5. Deleted player pts. 9,610
• 6. toshiue 32 pts. 9,608
• 7. kabubi 24 pts. 9,605
• 8. phi16 18 pts. 9,604
• 9. smilingone 14 pts. 9,596
• 10. LociOiling 10 pts. 9,596