Placeholder image of a protein
Icon representing a puzzle

1391: Revisiting Puzzle 115: Exocyst

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
June 15, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups

  1. Avatar for Gargleblasters
    1. Gargleblasters
    100 pts. 9,615
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 9,613
  3. Avatar for Void Crushers 3. Void Crushers 49 pts. 9,609
  4. Avatar for Go Science 4. Go Science 33 pts. 9,608
  5. Avatar for Beta Folders 5. Beta Folders 22 pts. 9,596
  6. Avatar for Contenders 6. Contenders 14 pts. 9,583
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 8 pts. 9,456
  8. Avatar for HMT heritage 8. HMT heritage 5 pts. 9,387
  9. Avatar for Marvin's bunch 9. Marvin's bunch 3 pts. 9,351
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 2 pts. 9,290
  1. Avatar for lamoille 11. lamoille Lv 1 7 pts. 9,596
  2. Avatar for bertro 12. bertro Lv 1 5 pts. 9,591
  3. Avatar for reefyrob 13. reefyrob Lv 1 4 pts. 9,583
  4. Avatar for gitwut 14. gitwut Lv 1 3 pts. 9,579
  5. Avatar for georg137 15. georg137 Lv 1 2 pts. 9,578
  6. Avatar for Deleted player 16. Deleted player pts. 9,564
  7. Avatar for retiredmichael 17. retiredmichael Lv 1 1 pt. 9,560
  8. Avatar for jermainiac 18. jermainiac Lv 1 1 pt. 9,544
  9. Avatar for mimi 19. mimi Lv 1 1 pt. 9,535
  10. Avatar for lupussapien 20. lupussapien Lv 1 1 pt. 9,439

Comments