Placeholder image of a protein
Icon representing a puzzle

1396: Unsolved De-novo Freestyle 108

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
June 27, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


STDDEVEKLREEVQRKGGKVEVKKENGKHKVRVKFETENKTVELTVTNEEQVKRMQKQVEEQIKK

Top groups

  1. Avatar for Deleted group 11. Deleted group pts. 8,946
  2. Avatar for xkcd 12. xkcd 2 pts. 8,761
  3. Avatar for Natural Abilities 13. Natural Abilities 2 pts. 8,752
  4. Avatar for Russian team 14. Russian team 1 pt. 8,750
  5. Avatar for Italiani Al Lavoro 15. Italiani Al Lavoro 1 pt. 8,694
  6. Avatar for GC Sommerlejr 2017 16. GC Sommerlejr 2017 1 pt. 8,667
  7. Avatar for Deleted group 17. Deleted group pts. 7,970
  8. Avatar for SciOne2017 18. SciOne2017 1 pt. 7,442
  9. Avatar for Topics in Bioscience and Biotech 19. Topics in Bioscience and Biotech 1 pt. 7,215
  10. Avatar for Deleted group 20. Deleted group pts. 5,517
  1. Avatar for anthion
    1. anthion Lv 1
    100 pts. 9,281
  2. Avatar for actiasluna 2. actiasluna Lv 1 83 pts. 9,280
  3. Avatar for Skippysk8s 3. Skippysk8s Lv 1 69 pts. 9,275
  4. Avatar for dizzywings 4. dizzywings Lv 1 56 pts. 9,268
  5. Avatar for Blipperman 5. Blipperman Lv 1 45 pts. 9,262
  6. Avatar for lupussapien 6. lupussapien Lv 1 36 pts. 9,260
  7. Avatar for Hollinas 7. Hollinas Lv 1 29 pts. 9,249
  8. Avatar for toshiue 8. toshiue Lv 1 23 pts. 9,248
  9. Avatar for Bruno Kestemont 9. Bruno Kestemont Lv 1 18 pts. 9,235
  10. Avatar for LociOiling 10. LociOiling Lv 1 14 pts. 9,220

Comments