Placeholder image of a protein
Icon representing a puzzle

1396: Unsolved De-novo Freestyle 108

Closed since almost 9 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
June 27, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


STDDEVEKLREEVQRKGGKVEVKKENGKHKVRVKFETENKTVELTVTNEEQVKRMQKQVEEQIKK

Top groups


  1. Avatar for Window Group 21. Window Group 1 pt. 0

  1. Avatar for anthion
    1. anthion Lv 1
    100 pts. 9,281
  2. Avatar for actiasluna 2. actiasluna Lv 1 83 pts. 9,280
  3. Avatar for Skippysk8s 3. Skippysk8s Lv 1 69 pts. 9,275
  4. Avatar for dizzywings 4. dizzywings Lv 1 56 pts. 9,268
  5. Avatar for Blipperman 5. Blipperman Lv 1 45 pts. 9,262
  6. Avatar for lupussapien 6. lupussapien Lv 1 36 pts. 9,260
  7. Avatar for Hollinas 7. Hollinas Lv 1 29 pts. 9,249
  8. Avatar for toshiue 8. toshiue Lv 1 23 pts. 9,248
  9. Avatar for Bruno Kestemont 9. Bruno Kestemont Lv 1 18 pts. 9,235
  10. Avatar for LociOiling 10. LociOiling Lv 1 14 pts. 9,220

Comments