Placeholder image of a protein
Icon representing a puzzle

1396: Unsolved De-novo Freestyle 108

Closed since almost 9 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
June 27, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


STDDEVEKLREEVQRKGGKVEVKKENGKHKVRVKFETENKTVELTVTNEEQVKRMQKQVEEQIKK

Top groups


  1. Avatar for Gargleblasters 100 pts. 9,283
  2. Avatar for Go Science 2. Go Science 78 pts. 9,249
  3. Avatar for Beta Folders 3. Beta Folders 60 pts. 9,220
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 45 pts. 9,218
  5. Avatar for Marvin's bunch 5. Marvin's bunch 33 pts. 9,194
  6. Avatar for Contenders 6. Contenders 24 pts. 9,178
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 17 pts. 9,162
  8. Avatar for Void Crushers 8. Void Crushers 12 pts. 9,155
  9. Avatar for HMT heritage 9. HMT heritage 8 pts. 9,128
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 6 pts. 9,091

  1. Avatar for Galaxie 11. Galaxie Lv 1 10 pts. 9,218
  2. Avatar for smilingone 12. smilingone Lv 1 8 pts. 9,217
  3. Avatar for lamoille 13. lamoille Lv 1 6 pts. 9,210
  4. Avatar for Deleted player 14. Deleted player pts. 9,210
  5. Avatar for gmn 15. gmn Lv 1 3 pts. 9,209
  6. Avatar for retiredmichael 16. retiredmichael Lv 1 2 pts. 9,198
  7. Avatar for jausmh 17. jausmh Lv 1 2 pts. 9,189
  8. Avatar for gitwut 18. gitwut Lv 1 1 pt. 9,173
  9. Avatar for Bletchley Park 19. Bletchley Park Lv 1 1 pt. 9,173
  10. Avatar for Deleted player 20. Deleted player pts. 9,171

Comments