Placeholder image of a protein
Icon representing a puzzle

1396: Unsolved De-novo Freestyle 108

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary


Created
June 27, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


STDDEVEKLREEVQRKGGKVEVKKENGKHKVRVKFETENKTVELTVTNEEQVKRMQKQVEEQIKK

Top groups


  1. Avatar for Gargleblasters 100 pts. 9,283
  2. Avatar for Go Science 2. Go Science 78 pts. 9,249
  3. Avatar for Beta Folders 3. Beta Folders 60 pts. 9,220
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 45 pts. 9,218
  5. Avatar for Marvin's bunch 5. Marvin's bunch 33 pts. 9,194
  6. Avatar for Contenders 6. Contenders 24 pts. 9,178
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 17 pts. 9,162
  8. Avatar for Void Crushers 8. Void Crushers 12 pts. 9,155
  9. Avatar for HMT heritage 9. HMT heritage 8 pts. 9,128
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 6 pts. 9,091

  1. Avatar for retiredmichael 11. retiredmichael Lv 1 72 pts. 9,198
  2. Avatar for Blipperman 12. Blipperman Lv 1 69 pts. 9,197
  3. Avatar for Bruno Kestemont 13. Bruno Kestemont Lv 1 67 pts. 9,194
  4. Avatar for frood66 14. frood66 Lv 1 65 pts. 9,194
  5. Avatar for Galaxie 15. Galaxie Lv 1 62 pts. 9,186
  6. Avatar for eusair 16. eusair Lv 1 60 pts. 9,186
  7. Avatar for gitwut 17. gitwut Lv 1 58 pts. 9,178
  8. Avatar for jobo0502 18. jobo0502 Lv 1 56 pts. 9,162
  9. Avatar for Deleted player 19. Deleted player pts. 9,158
  10. Avatar for Timo van der Laan 20. Timo van der Laan Lv 1 52 pts. 9,155

Comments