Placeholder image of a protein
Icon representing a puzzle

1396: Unsolved De-novo Freestyle 108

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary


Created
June 27, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


STDDEVEKLREEVQRKGGKVEVKKENGKHKVRVKFETENKTVELTVTNEEQVKRMQKQVEEQIKK

Top groups


  1. Avatar for Gargleblasters 100 pts. 9,283
  2. Avatar for Go Science 2. Go Science 78 pts. 9,249
  3. Avatar for Beta Folders 3. Beta Folders 60 pts. 9,220
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 45 pts. 9,218
  5. Avatar for Marvin's bunch 5. Marvin's bunch 33 pts. 9,194
  6. Avatar for Contenders 6. Contenders 24 pts. 9,178
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 17 pts. 9,162
  8. Avatar for Void Crushers 8. Void Crushers 12 pts. 9,155
  9. Avatar for HMT heritage 9. HMT heritage 8 pts. 9,128
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 6 pts. 9,091

  1. Avatar for Deleted player 71. Deleted player pts. 8,901
  2. Avatar for Marvelz 72. Marvelz Lv 1 5 pts. 8,899
  3. Avatar for fishercat 73. fishercat Lv 1 5 pts. 8,898
  4. Avatar for SKSbell 74. SKSbell Lv 1 4 pts. 8,876
  5. Avatar for FractalCuber 75. FractalCuber Lv 1 4 pts. 8,873
  6. Avatar for andrewtmaxwell 76. andrewtmaxwell Lv 1 4 pts. 8,864
  7. Avatar for Bautho 77. Bautho Lv 1 4 pts. 8,840
  8. Avatar for Anton Trikshev 78. Anton Trikshev Lv 1 4 pts. 8,839
  9. Avatar for uihcv 79. uihcv Lv 1 3 pts. 8,837
  10. Avatar for tomespen 80. tomespen Lv 1 3 pts. 8,825

Comments