Placeholder image of a protein
Icon representing a puzzle

1397: Revisiting Puzzle 124: PDZ Domain

Closed since over 8 years ago

Intermediate Overall Prediction

Summary


Created
June 29, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 2 pts. 9,137
  2. Avatar for xkcd 12. xkcd 1 pt. 8,959
  3. Avatar for Russian team 13. Russian team 1 pt. 8,934
  4. Avatar for Natural Abilities 14. Natural Abilities 1 pt. 8,844
  5. Avatar for Deleted group 15. Deleted group pts. 8,549
  6. Avatar for Team South Africa 16. Team South Africa 1 pt. 8,469
  7. Avatar for GUGITBIOTECH 17. GUGITBIOTECH 1 pt. 8,468
  8. Avatar for BIO257C 18. BIO257C 1 pt. 8,425
  9. Avatar for Window Group 19. Window Group 1 pt. 8,328

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 9,470
  2. Avatar for smilingone 2. smilingone Lv 1 79 pts. 9,469
  3. Avatar for Galaxie 3. Galaxie Lv 1 61 pts. 9,437
  4. Avatar for lamoille 4. lamoille Lv 1 47 pts. 9,435
  5. Avatar for retiredmichael 5. retiredmichael Lv 1 35 pts. 9,415
  6. Avatar for Bletchley Park 6. Bletchley Park Lv 1 26 pts. 9,413
  7. Avatar for anthion 7. anthion Lv 1 19 pts. 9,409
  8. Avatar for gmn 8. gmn Lv 1 14 pts. 9,402
  9. Avatar for georg137 9. georg137 Lv 1 10 pts. 9,399
  10. Avatar for mimi 10. mimi Lv 1 7 pts. 9,393

Comments