Placeholder image of a protein
Icon representing a puzzle

1397: Revisiting Puzzle 124: PDZ Domain

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
June 29, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,470
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 76 pts. 9,437
  3. Avatar for Contenders 3. Contenders 56 pts. 9,413
  4. Avatar for Gargleblasters 4. Gargleblasters 41 pts. 9,409
  5. Avatar for Void Crushers 5. Void Crushers 29 pts. 9,394
  6. Avatar for Go Science 6. Go Science 20 pts. 9,390
  7. Avatar for Marvin's bunch 7. Marvin's bunch 14 pts. 9,371
  8. Avatar for HMT heritage 8. HMT heritage 9 pts. 9,351
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 6 pts. 9,302
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 4 pts. 9,209
  1. Avatar for Deleted player 11. Deleted player pts. 9,389
  2. Avatar for toshiue 12. toshiue Lv 1 3 pts. 9,364
  3. Avatar for Hollinas 13. Hollinas Lv 1 2 pts. 9,364
  4. Avatar for Bruno Kestemont 14. Bruno Kestemont Lv 1 1 pt. 9,362
  5. Avatar for phi16 15. phi16 Lv 1 1 pt. 9,362
  6. Avatar for Anfinsen_slept_here 16. Anfinsen_slept_here Lv 1 1 pt. 9,358
  7. Avatar for jausmh 17. jausmh Lv 1 1 pt. 9,336
  8. Avatar for reefyrob 18. reefyrob Lv 1 1 pt. 9,292
  9. Avatar for Deleted player 19. Deleted player pts. 9,290
  10. Avatar for Blipperman 20. Blipperman Lv 1 1 pt. 9,249

Comments