Placeholder image of a protein
Icon representing a puzzle

1397: Revisiting Puzzle 124: PDZ Domain

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary


Created
June 29, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups


  1. Avatar for Beta Folders 100 pts. 9,470
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 76 pts. 9,437
  3. Avatar for Contenders 3. Contenders 56 pts. 9,413
  4. Avatar for Gargleblasters 4. Gargleblasters 41 pts. 9,409
  5. Avatar for Void Crushers 5. Void Crushers 29 pts. 9,394
  6. Avatar for Go Science 6. Go Science 20 pts. 9,390
  7. Avatar for Marvin's bunch 7. Marvin's bunch 14 pts. 9,371
  8. Avatar for HMT heritage 8. HMT heritage 9 pts. 9,351
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 6 pts. 9,302
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 4 pts. 9,209

  1. Avatar for eusair
    1. eusair Lv 1
    100 pts. 9,461
  2. Avatar for Galaxie 2. Galaxie Lv 1 97 pts. 9,437
  3. Avatar for dcrwheeler 3. dcrwheeler Lv 1 94 pts. 9,427
  4. Avatar for actiasluna 4. actiasluna Lv 1 91 pts. 9,408
  5. Avatar for Deleted player 5. Deleted player pts. 9,398
  6. Avatar for Timo van der Laan 6. Timo van der Laan Lv 1 85 pts. 9,394
  7. Avatar for ZeroLeak7 7. ZeroLeak7 Lv 1 82 pts. 9,390
  8. Avatar for retiredmichael 8. retiredmichael Lv 1 79 pts. 9,385
  9. Avatar for crpainter 9. crpainter Lv 1 76 pts. 9,382
  10. Avatar for markm457 10. markm457 Lv 1 74 pts. 9,375

Comments