Placeholder image of a protein
Icon representing a puzzle

1397: Revisiting Puzzle 124: PDZ Domain

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary


Created
June 29, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups


  1. Avatar for Beta Folders 100 pts. 9,470
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 76 pts. 9,437
  3. Avatar for Contenders 3. Contenders 56 pts. 9,413
  4. Avatar for Gargleblasters 4. Gargleblasters 41 pts. 9,409
  5. Avatar for Void Crushers 5. Void Crushers 29 pts. 9,394
  6. Avatar for Go Science 6. Go Science 20 pts. 9,390
  7. Avatar for Marvin's bunch 7. Marvin's bunch 14 pts. 9,371
  8. Avatar for HMT heritage 8. HMT heritage 9 pts. 9,351
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 6 pts. 9,302
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 4 pts. 9,209

  1. Avatar for navn 111. navn Lv 1 1 pt. 8,808
  2. Avatar for senor pit 112. senor pit Lv 1 1 pt. 8,786
  3. Avatar for Iron pet 113. Iron pet Lv 1 1 pt. 8,784
  4. Avatar for cherry39 114. cherry39 Lv 1 1 pt. 8,778
  5. Avatar for lamoille 115. lamoille Lv 1 1 pt. 8,757
  6. Avatar for cbwest 116. cbwest Lv 1 1 pt. 8,727
  7. Avatar for drjr 117. drjr Lv 1 1 pt. 8,724
  8. Avatar for trentis1 118. trentis1 Lv 1 1 pt. 8,689
  9. Avatar for MadCat08 119. MadCat08 Lv 1 1 pt. 8,637
  10. Avatar for uihcv 120. uihcv Lv 1 1 pt. 8,613

Comments