Placeholder image of a protein
Icon representing a puzzle

1397: Revisiting Puzzle 124: PDZ Domain

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary


Created
June 29, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups


  1. Avatar for Beta Folders 100 pts. 9,470
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 76 pts. 9,437
  3. Avatar for Contenders 3. Contenders 56 pts. 9,413
  4. Avatar for Gargleblasters 4. Gargleblasters 41 pts. 9,409
  5. Avatar for Void Crushers 5. Void Crushers 29 pts. 9,394
  6. Avatar for Go Science 6. Go Science 20 pts. 9,390
  7. Avatar for Marvin's bunch 7. Marvin's bunch 14 pts. 9,371
  8. Avatar for HMT heritage 8. HMT heritage 9 pts. 9,351
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 6 pts. 9,302
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 4 pts. 9,209

  1. Avatar for jermainiac 51. jermainiac Lv 1 13 pts. 9,171
  2. Avatar for WBarme1234 52. WBarme1234 Lv 1 13 pts. 9,170
  3. Avatar for alcor29 53. alcor29 Lv 1 12 pts. 9,170
  4. Avatar for johngran 54. johngran Lv 1 12 pts. 9,169
  5. Avatar for Anfinsen_slept_here 55. Anfinsen_slept_here Lv 1 11 pts. 9,162
  6. Avatar for SKSbell 56. SKSbell Lv 1 10 pts. 9,160
  7. Avatar for jausmh 57. jausmh Lv 1 10 pts. 9,158
  8. Avatar for dizzywings 58. dizzywings Lv 1 9 pts. 9,154
  9. Avatar for Jim Fraser 59. Jim Fraser Lv 1 9 pts. 9,152
  10. Avatar for isaksson 60. isaksson Lv 1 9 pts. 9,151

Comments