Placeholder image of a protein
Icon representing a puzzle

1397: Revisiting Puzzle 124: PDZ Domain

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary


Created
June 29, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups


  1. Avatar for Beta Folders 100 pts. 9,470
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 76 pts. 9,437
  3. Avatar for Contenders 3. Contenders 56 pts. 9,413
  4. Avatar for Gargleblasters 4. Gargleblasters 41 pts. 9,409
  5. Avatar for Void Crushers 5. Void Crushers 29 pts. 9,394
  6. Avatar for Go Science 6. Go Science 20 pts. 9,390
  7. Avatar for Marvin's bunch 7. Marvin's bunch 14 pts. 9,371
  8. Avatar for HMT heritage 8. HMT heritage 9 pts. 9,351
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 6 pts. 9,302
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 4 pts. 9,209

  1. Avatar for froggs554 71. froggs554 Lv 1 5 pts. 9,083
  2. Avatar for Superphosphate 72. Superphosphate Lv 1 4 pts. 9,080
  3. Avatar for fishercat 73. fishercat Lv 1 4 pts. 9,067
  4. Avatar for TastyMunchies 74. TastyMunchies Lv 1 4 pts. 9,059
  5. Avatar for fpc 76. fpc Lv 1 4 pts. 9,029
  6. Avatar for phi16 77. phi16 Lv 1 3 pts. 9,026
  7. Avatar for katling 78. katling Lv 1 3 pts. 9,022
  8. Avatar for tarimo 79. tarimo Lv 1 3 pts. 9,020
  9. Avatar for Deleted player 80. Deleted player pts. 9,010

Comments