Placeholder image of a protein
Icon representing a puzzle

1397: Revisiting Puzzle 124: PDZ Domain

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary


Created
June 29, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups


  1. Avatar for Beta Folders 100 pts. 9,470
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 76 pts. 9,437
  3. Avatar for Contenders 3. Contenders 56 pts. 9,413
  4. Avatar for Gargleblasters 4. Gargleblasters 41 pts. 9,409
  5. Avatar for Void Crushers 5. Void Crushers 29 pts. 9,394
  6. Avatar for Go Science 6. Go Science 20 pts. 9,390
  7. Avatar for Marvin's bunch 7. Marvin's bunch 14 pts. 9,371
  8. Avatar for HMT heritage 8. HMT heritage 9 pts. 9,351
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 6 pts. 9,302
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 4 pts. 9,209

  1. Avatar for FishKAA 81. FishKAA Lv 1 3 pts. 9,008
  2. Avatar for Crossed Sticks 82. Crossed Sticks Lv 1 2 pts. 9,005
  3. Avatar for carsonfb 83. carsonfb Lv 1 2 pts. 8,997
  4. Avatar for Merf 84. Merf Lv 1 2 pts. 8,994
  5. Avatar for bcre8tvv 85. bcre8tvv Lv 1 2 pts. 8,988
  6. Avatar for ViJay7019 86. ViJay7019 Lv 1 2 pts. 8,985
  7. Avatar for Deleted player 87. Deleted player 2 pts. 8,981
  8. Avatar for NinjaGreg 88. NinjaGreg Lv 1 2 pts. 8,979
  9. Avatar for dbuske 89. dbuske Lv 1 2 pts. 8,973
  10. Avatar for SaraL 90. SaraL Lv 1 2 pts. 8,972

Comments