Placeholder image of a protein
Icon representing a puzzle

1400: Revisiting Puzzle 125: Ice Binding Protein

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
July 06, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 2 pts. 8,845
  2. Avatar for Natural Abilities 12. Natural Abilities 1 pt. 8,771
  3. Avatar for :) 13. :) 1 pt. 8,672
  4. Avatar for xkcd 14. xkcd 1 pt. 8,667
  5. Avatar for Russian team 15. Russian team 1 pt. 8,630
  6. Avatar for Deleted group 16. Deleted group pts. 8,266
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 8,110
  8. Avatar for freefolder 18. freefolder 1 pt. 7,966
  1. Avatar for poiuyqwert 121. poiuyqwert Lv 1 1 pt. 8,313
  2. Avatar for Erica_W 122. Erica_W Lv 1 1 pt. 8,266
  3. Avatar for NotJim99 123. NotJim99 Lv 1 1 pt. 8,257
  4. Avatar for elvis19965 124. elvis19965 Lv 1 1 pt. 8,255
  5. Avatar for Rollter 125. Rollter Lv 1 1 pt. 8,251
  6. Avatar for Gojira 126. Gojira Lv 1 1 pt. 8,248
  7. Avatar for a791412276 127. a791412276 Lv 1 1 pt. 8,241
  8. Avatar for camph 128. camph Lv 1 1 pt. 8,223
  9. Avatar for star7777777 129. star7777777 Lv 1 1 pt. 8,202
  10. Avatar for z0mBy 130. z0mBy Lv 1 1 pt. 8,196

Comments