Placeholder image of a protein
Icon representing a puzzle

1400: Revisiting Puzzle 125: Ice Binding Protein

Closed since over 8 years ago

Intermediate Overall Prediction

Summary


Created
July 06, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 2 pts. 8,845
  2. Avatar for Natural Abilities 12. Natural Abilities 1 pt. 8,771
  3. Avatar for :) 13. :) 1 pt. 8,672
  4. Avatar for xkcd 14. xkcd 1 pt. 8,667
  5. Avatar for Russian team 15. Russian team 1 pt. 8,630
  6. Avatar for Deleted group 16. Deleted group pts. 8,266
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 8,110
  8. Avatar for freefolder 18. freefolder 1 pt. 7,966

  1. Avatar for Bletchley Park 141. Bletchley Park Lv 1 1 pt. 7,989
  2. Avatar for Imeturoran 142. Imeturoran Lv 1 1 pt. 7,966
  3. Avatar for momadoc 143. momadoc Lv 1 1 pt. 7,955
  4. Avatar for mrmojo666 144. mrmojo666 Lv 1 1 pt. 7,730
  5. Avatar for pandapharmd 145. pandapharmd Lv 1 1 pt. 7,730
  6. Avatar for ProHarTius 146. ProHarTius Lv 1 1 pt. 7,640
  7. Avatar for RAMUS 147. RAMUS Lv 1 1 pt. 7,232
  8. Avatar for justjustin 148. justjustin Lv 1 1 pt. 7,232
  9. Avatar for CianPanda 149. CianPanda Lv 1 1 pt. 6,919
  10. Avatar for with_science 150. with_science Lv 1 1 pt. 6,875

Comments