Placeholder image of a protein
Icon representing a puzzle

1400: Revisiting Puzzle 125: Ice Binding Protein

Closed since over 8 years ago

Intermediate Overall Prediction

Summary


Created
July 06, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 2 pts. 8,845
  2. Avatar for Natural Abilities 12. Natural Abilities 1 pt. 8,771
  3. Avatar for :) 13. :) 1 pt. 8,672
  4. Avatar for xkcd 14. xkcd 1 pt. 8,667
  5. Avatar for Russian team 15. Russian team 1 pt. 8,630
  6. Avatar for Deleted group 16. Deleted group pts. 8,266
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 8,110
  8. Avatar for freefolder 18. freefolder 1 pt. 7,966

  1. Avatar for andrewxc 31. andrewxc Lv 1 34 pts. 8,934
  2. Avatar for christioanchauvin 32. christioanchauvin Lv 1 33 pts. 8,929
  3. Avatar for diamonddays 33. diamonddays Lv 1 32 pts. 8,924
  4. Avatar for dssb 34. dssb Lv 1 30 pts. 8,922
  5. Avatar for randomlil 35. randomlil Lv 1 29 pts. 8,922
  6. Avatar for nicobul 36. nicobul Lv 1 28 pts. 8,921
  7. Avatar for jobo0502 37. jobo0502 Lv 1 27 pts. 8,909
  8. Avatar for MicElephant 38. MicElephant Lv 1 26 pts. 8,904
  9. Avatar for carsonfb 39. carsonfb Lv 1 25 pts. 8,900
  10. Avatar for weitzen 40. weitzen Lv 1 24 pts. 8,900

Comments