1400: Revisiting Puzzle 125: Ice Binding Protein
Closed since over 8 years ago
Intermediate Overall PredictionSummary
- Created
- July 06, 2017
- Expires
- Max points
- 100
This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.
Sequence:
ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA
