Placeholder image of a protein
Icon representing a puzzle

1400: Revisiting Puzzle 125: Ice Binding Protein

Closed since almost 9 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
July 06, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups


  1. Avatar for HMT heritage 100 pts. 9,027
  2. Avatar for Contenders 2. Contenders 74 pts. 9,022
  3. Avatar for Go Science 3. Go Science 54 pts. 9,014
  4. Avatar for Beta Folders 4. Beta Folders 38 pts. 9,014
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 27 pts. 9,001
  6. Avatar for Gargleblasters 6. Gargleblasters 18 pts. 8,992
  7. Avatar for Void Crushers 7. Void Crushers 12 pts. 8,966
  8. Avatar for FoldIt@Netherlands 8. FoldIt@Netherlands 8 pts. 8,962
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 5 pts. 8,929
  10. Avatar for Marvin's bunch 10. Marvin's bunch 3 pts. 8,894

  1. Avatar for poiuyqwert 121. poiuyqwert Lv 1 1 pt. 8,313
  2. Avatar for Erica_W 122. Erica_W Lv 1 1 pt. 8,266
  3. Avatar for NotJim99 123. NotJim99 Lv 1 1 pt. 8,257
  4. Avatar for elvis19965 124. elvis19965 Lv 1 1 pt. 8,255
  5. Avatar for Rollter 125. Rollter Lv 1 1 pt. 8,251
  6. Avatar for Gojira 126. Gojira Lv 1 1 pt. 8,248
  7. Avatar for a791412276 127. a791412276 Lv 1 1 pt. 8,241
  8. Avatar for camph 128. camph Lv 1 1 pt. 8,223
  9. Avatar for star7777777 129. star7777777 Lv 1 1 pt. 8,202
  10. Avatar for z0mBy 130. z0mBy Lv 1 1 pt. 8,196

Comments