Placeholder image of a protein
Icon representing a puzzle

1400: Revisiting Puzzle 125: Ice Binding Protein

Closed since almost 9 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
July 06, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups


  1. Avatar for HMT heritage 100 pts. 9,027
  2. Avatar for Contenders 2. Contenders 74 pts. 9,022
  3. Avatar for Go Science 3. Go Science 54 pts. 9,014
  4. Avatar for Beta Folders 4. Beta Folders 38 pts. 9,014
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 27 pts. 9,001
  6. Avatar for Gargleblasters 6. Gargleblasters 18 pts. 8,992
  7. Avatar for Void Crushers 7. Void Crushers 12 pts. 8,966
  8. Avatar for FoldIt@Netherlands 8. FoldIt@Netherlands 8 pts. 8,962
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 5 pts. 8,929
  10. Avatar for Marvin's bunch 10. Marvin's bunch 3 pts. 8,894

  1. Avatar for Bletchley Park 141. Bletchley Park Lv 1 1 pt. 7,989
  2. Avatar for Imeturoran 142. Imeturoran Lv 1 1 pt. 7,966
  3. Avatar for momadoc 143. momadoc Lv 1 1 pt. 7,955
  4. Avatar for mrmojo666 144. mrmojo666 Lv 1 1 pt. 7,730
  5. Avatar for pandapharmd 145. pandapharmd Lv 1 1 pt. 7,730
  6. Avatar for ProHarTius 146. ProHarTius Lv 1 1 pt. 7,640
  7. Avatar for RAMUS 147. RAMUS Lv 1 1 pt. 7,232
  8. Avatar for justjustin 148. justjustin Lv 1 1 pt. 7,232
  9. Avatar for CianPanda 149. CianPanda Lv 1 1 pt. 6,919
  10. Avatar for with_science 150. with_science Lv 1 1 pt. 6,875

Comments