Placeholder image of a protein
Icon representing a puzzle

1403: Revisiting Puzzle 126: Ethanolamine Utilization

Closed since over 8 years ago

Intermediate Overall Prediction

Summary


Created
July 12, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein allows bacteria to metabolize ethanolamine and use it in constructing cell walls and cell membranes. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKLAVVTGQIVCTVRHHGLAHDKLLMVEMIDPQGNPDGQCAVAIDNIGAGTGEWVLLVSGSSARQAHKSETSPVDLCVIGIVDEVVSGGQVIFHK

Top groups


  1. Avatar for :) 11. :) 1 pt. 8,688
  2. Avatar for xkcd 12. xkcd 1 pt. 8,683
  3. Avatar for Russian team 13. Russian team 1 pt. 8,581
  4. Avatar for Natural Abilities 14. Natural Abilities 1 pt. 8,480
  5. Avatar for Kotocycle 15. Kotocycle 1 pt. 8,468
  6. Avatar for GC Sommerlejr 2017 16. GC Sommerlejr 2017 1 pt. 8,183
  7. Avatar for Deleted group 17. Deleted group pts. 7,101

  1. Avatar for Soggy Doglog 101. Soggy Doglog Lv 1 1 pt. 8,424
  2. Avatar for Iron pet 102. Iron pet Lv 1 1 pt. 8,417
  3. Avatar for senor pit 103. senor pit Lv 1 1 pt. 8,390
  4. Avatar for Mike Cassidy 104. Mike Cassidy Lv 1 1 pt. 8,388
  5. Avatar for YeshuaLives 105. YeshuaLives Lv 1 1 pt. 8,385
  6. Avatar for DScott 106. DScott Lv 1 1 pt. 8,328
  7. Avatar for FractalCuber 107. FractalCuber Lv 1 1 pt. 8,266
  8. Avatar for rinze 108. rinze Lv 1 1 pt. 8,245
  9. Avatar for Pibeagles 109. Pibeagles Lv 1 1 pt. 8,238
  10. Avatar for Keresto 110. Keresto Lv 1 1 pt. 8,236

Comments