Placeholder image of a protein
Icon representing a puzzle

1403: Revisiting Puzzle 126: Ethanolamine Utilization

Closed since over 8 years ago

Intermediate Overall Prediction

Summary


Created
July 12, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein allows bacteria to metabolize ethanolamine and use it in constructing cell walls and cell membranes. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKLAVVTGQIVCTVRHHGLAHDKLLMVEMIDPQGNPDGQCAVAIDNIGAGTGEWVLLVSGSSARQAHKSETSPVDLCVIGIVDEVVSGGQVIFHK

Top groups


  1. Avatar for :) 11. :) 1 pt. 8,688
  2. Avatar for xkcd 12. xkcd 1 pt. 8,683
  3. Avatar for Russian team 13. Russian team 1 pt. 8,581
  4. Avatar for Natural Abilities 14. Natural Abilities 1 pt. 8,480
  5. Avatar for Kotocycle 15. Kotocycle 1 pt. 8,468
  6. Avatar for GC Sommerlejr 2017 16. GC Sommerlejr 2017 1 pt. 8,183
  7. Avatar for Deleted group 17. Deleted group pts. 7,101

  1. Avatar for Arne Heessels 111. Arne Heessels Lv 1 1 pt. 8,224
  2. Avatar for rabamino12358 112. rabamino12358 Lv 1 1 pt. 8,205
  3. Avatar for momadoc 113. momadoc Lv 1 1 pt. 8,204
  4. Avatar for DrCompchem 114. DrCompchem Lv 1 1 pt. 8,183
  5. Avatar for Crossed Sticks 115. Crossed Sticks Lv 1 1 pt. 8,173
  6. Avatar for hada 116. hada Lv 1 1 pt. 8,146
  7. Avatar for zxlitening 117. zxlitening Lv 1 1 pt. 8,097
  8. Avatar for Avi.kawa 118. Avi.kawa Lv 1 1 pt. 8,087
  9. Avatar for wuhongzei 119. wuhongzei Lv 1 1 pt. 8,068
  10. Avatar for hama1993 120. hama1993 Lv 1 1 pt. 8,040

Comments