Placeholder image of a protein
Icon representing a puzzle

1403: Revisiting Puzzle 126: Ethanolamine Utilization

Closed since over 8 years ago

Intermediate Overall Prediction

Summary


Created
July 12, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein allows bacteria to metabolize ethanolamine and use it in constructing cell walls and cell membranes. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKLAVVTGQIVCTVRHHGLAHDKLLMVEMIDPQGNPDGQCAVAIDNIGAGTGEWVLLVSGSSARQAHKSETSPVDLCVIGIVDEVVSGGQVIFHK

Top groups


  1. Avatar for :) 11. :) 1 pt. 8,688
  2. Avatar for xkcd 12. xkcd 1 pt. 8,683
  3. Avatar for Russian team 13. Russian team 1 pt. 8,581
  4. Avatar for Natural Abilities 14. Natural Abilities 1 pt. 8,480
  5. Avatar for Kotocycle 15. Kotocycle 1 pt. 8,468
  6. Avatar for GC Sommerlejr 2017 16. GC Sommerlejr 2017 1 pt. 8,183
  7. Avatar for Deleted group 17. Deleted group pts. 7,101

  1. Avatar for Jspirit 141. Jspirit Lv 1 1 pt. 7,225
  2. Avatar for eromana 142. eromana Lv 1 1 pt. 7,224
  3. Avatar for arlettelh97 143. arlettelh97 Lv 1 1 pt. 7,101
  4. Avatar for Haeri 144. Haeri Lv 1 1 pt. 7,063
  5. Avatar for AeonFluff 145. AeonFluff Lv 1 1 pt. 7,053
  6. Avatar for Erica_W 146. Erica_W Lv 1 1 pt. 7,037
  7. Avatar for dam_01 147. dam_01 Lv 1 1 pt. 5,403
  8. Avatar for Threeoak 148. Threeoak Lv 1 1 pt. 5,396
  9. Avatar for Friedo12345 149. Friedo12345 Lv 1 1 pt. 5,396
  10. Avatar for 8bitpineapple 150. 8bitpineapple Lv 1 1 pt. 5,396

Comments