Placeholder image of a protein
Icon representing a puzzle

1403: Revisiting Puzzle 126: Ethanolamine Utilization

Closed since over 8 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
July 12, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein allows bacteria to metabolize ethanolamine and use it in constructing cell walls and cell membranes. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKLAVVTGQIVCTVRHHGLAHDKLLMVEMIDPQGNPDGQCAVAIDNIGAGTGEWVLLVSGSSARQAHKSETSPVDLCVIGIVDEVVSGGQVIFHK

Top groups


  1. Avatar for :) 11. :) 1 pt. 8,688
  2. Avatar for xkcd 12. xkcd 1 pt. 8,683
  3. Avatar for Russian team 13. Russian team 1 pt. 8,581
  4. Avatar for Natural Abilities 14. Natural Abilities 1 pt. 8,480
  5. Avatar for Kotocycle 15. Kotocycle 1 pt. 8,468
  6. Avatar for GC Sommerlejr 2017 16. GC Sommerlejr 2017 1 pt. 8,183
  7. Avatar for Deleted group 17. Deleted group pts. 7,101

  1. Avatar for Norrjane 31. Norrjane Lv 1 35 pts. 9,020
  2. Avatar for andrewxc 32. andrewxc Lv 1 34 pts. 9,016
  3. Avatar for christioanchauvin 33. christioanchauvin Lv 1 32 pts. 9,005
  4. Avatar for johnmitch 34. johnmitch Lv 1 31 pts. 9,001
  5. Avatar for frood66 35. frood66 Lv 1 30 pts. 8,998
  6. Avatar for O Seki To 36. O Seki To Lv 1 29 pts. 8,985
  7. Avatar for altejoh 37. altejoh Lv 1 28 pts. 8,982
  8. Avatar for Deleted player 38. Deleted player pts. 8,964
  9. Avatar for guineapig 39. guineapig Lv 1 26 pts. 8,957
  10. Avatar for Vinara 40. Vinara Lv 1 24 pts. 8,935

Comments