1403: Revisiting Puzzle 126: Ethanolamine Utilization
Closed since over 8 years ago
Intermediate Intermediate Overall Overall Prediction PredictionSummary
- Created
- July 12, 2017
- Expires
- Max points
- 100
This is a throwback puzzle to the early days of Foldit. This protein allows bacteria to metabolize ethanolamine and use it in constructing cell walls and cell membranes. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.
Sequence:
MKLAVVTGQIVCTVRHHGLAHDKLLMVEMIDPQGNPDGQCAVAIDNIGAGTGEWVLLVSGSSARQAHKSETSPVDLCVIGIVDEVVSGGQVIFHK
