Placeholder image of a protein
Icon representing a puzzle

1403: Revisiting Puzzle 126: Ethanolamine Utilization

Closed since over 8 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
July 12, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein allows bacteria to metabolize ethanolamine and use it in constructing cell walls and cell membranes. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKLAVVTGQIVCTVRHHGLAHDKLLMVEMIDPQGNPDGQCAVAIDNIGAGTGEWVLLVSGSSARQAHKSETSPVDLCVIGIVDEVVSGGQVIFHK

Top groups


  1. Avatar for Beta Folders 100 pts. 9,314
  2. Avatar for Go Science 2. Go Science 73 pts. 9,271
  3. Avatar for Contenders 3. Contenders 52 pts. 9,270
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 36 pts. 9,218
  5. Avatar for Gargleblasters 5. Gargleblasters 24 pts. 9,212
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 16 pts. 9,156
  7. Avatar for Void Crushers 7. Void Crushers 10 pts. 9,134
  8. Avatar for Marvin's bunch 8. Marvin's bunch 6 pts. 8,998
  9. Avatar for HMT heritage 9. HMT heritage 4 pts. 8,985
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 2 pts. 8,807

  1. Avatar for lamoille 131. lamoille Lv 1 1 pt. 7,668
  2. Avatar for martinf 132. martinf Lv 1 1 pt. 7,635
  3. Avatar for fujioyama 133. fujioyama Lv 1 1 pt. 7,536
  4. Avatar for fishercat 134. fishercat Lv 1 1 pt. 7,505
  5. Avatar for NotJim99 135. NotJim99 Lv 1 1 pt. 7,408
  6. Avatar for DogeSka 136. DogeSka Lv 1 1 pt. 7,369
  7. Avatar for David M. 137. David M. Lv 1 1 pt. 7,353
  8. Avatar for Giantbluefish 138. Giantbluefish Lv 1 1 pt. 7,342
  9. Avatar for ThomasWester 139. ThomasWester Lv 1 1 pt. 7,339
  10. Avatar for Plumby 140. Plumby Lv 1 1 pt. 7,330

Comments