Placeholder image of a protein
Icon representing a puzzle

1403: Revisiting Puzzle 126: Ethanolamine Utilization

Closed since over 8 years ago

Intermediate Overall Prediction

Summary


Created
July 12, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein allows bacteria to metabolize ethanolamine and use it in constructing cell walls and cell membranes. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKLAVVTGQIVCTVRHHGLAHDKLLMVEMIDPQGNPDGQCAVAIDNIGAGTGEWVLLVSGSSARQAHKSETSPVDLCVIGIVDEVVSGGQVIFHK

Top groups


  1. Avatar for Beta Folders 100 pts. 9,314
  2. Avatar for Go Science 2. Go Science 73 pts. 9,271
  3. Avatar for Contenders 3. Contenders 52 pts. 9,270
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 36 pts. 9,218
  5. Avatar for Gargleblasters 5. Gargleblasters 24 pts. 9,212
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 16 pts. 9,156
  7. Avatar for Void Crushers 7. Void Crushers 10 pts. 9,134
  8. Avatar for Marvin's bunch 8. Marvin's bunch 6 pts. 8,998
  9. Avatar for HMT heritage 9. HMT heritage 4 pts. 8,985
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 2 pts. 8,807

  1. Avatar for Flagg65a 51. Flagg65a Lv 1 15 pts. 8,836
  2. Avatar for jobo0502 52. jobo0502 Lv 1 15 pts. 8,828
  3. Avatar for Glen B 53. Glen B Lv 1 14 pts. 8,822
  4. Avatar for SKSbell 54. SKSbell Lv 1 13 pts. 8,820
  5. Avatar for pvc78 55. pvc78 Lv 1 13 pts. 8,820
  6. Avatar for NinjaGreg 56. NinjaGreg Lv 1 12 pts. 8,815
  7. Avatar for johngran 57. johngran Lv 1 12 pts. 8,808
  8. Avatar for deLaCeiba 58. deLaCeiba Lv 1 11 pts. 8,807
  9. Avatar for dizzywings 59. dizzywings Lv 1 10 pts. 8,784
  10. Avatar for alcor29 60. alcor29 Lv 1 10 pts. 8,778

Comments