Placeholder image of a protein
Icon representing a puzzle

1405: Unsolved De-novo Freestyle 111

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
July 18, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


HDEEERQRQLKKFKEWSKKQSNNTRMEERHHNGKRVLVIVVGDSESVIEIENGQVRSEVRSGTDEDSTRSMKELSEELRKLKDKL

Top groups

  1. Avatar for xkcd 11. xkcd 5 pts. 9,007
  2. Avatar for Deleted group 12. Deleted group pts. 8,921
  3. Avatar for Natural Abilities 13. Natural Abilities 2 pts. 8,827
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 2 pts. 8,718
  5. Avatar for GC Sommerlejr 2017 15. GC Sommerlejr 2017 1 pt. 8,663
  6. Avatar for FoldIt@Netherlands 16. FoldIt@Netherlands 1 pt. 8,412
  7. Avatar for Deleted group 17. Deleted group pts. 8,385
  8. Avatar for :) 18. :) 1 pt. 8,197
  9. Avatar for Boinformatics and biotechnology course 19. Boinformatics and biotechnology course 1 pt. 8,178
  10. Avatar for SETI.Germany 20. SETI.Germany 1 pt. 7,803
  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 9,685
  2. Avatar for Deleted player 2. Deleted player pts. 9,673
  3. Avatar for lamoille 3. lamoille Lv 1 71 pts. 9,668
  4. Avatar for gmn 4. gmn Lv 1 60 pts. 9,658
  5. Avatar for phi16 5. phi16 Lv 1 49 pts. 9,657
  6. Avatar for actiasluna 6. actiasluna Lv 1 41 pts. 9,656
  7. Avatar for Skippysk8s 7. Skippysk8s Lv 1 33 pts. 9,655
  8. Avatar for Blipperman 8. Blipperman Lv 1 27 pts. 9,653
  9. Avatar for alwen 9. alwen Lv 1 22 pts. 9,572
  10. Avatar for LociOiling 10. LociOiling Lv 1 17 pts. 9,572

Comments