Placeholder image of a protein
Icon representing a puzzle

1405: Unsolved De-novo Freestyle 111

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
July 18, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


HDEEERQRQLKKFKEWSKKQSNNTRMEERHHNGKRVLVIVVGDSESVIEIENGQVRSEVRSGTDEDSTRSMKELSEELRKLKDKL

Top groups

  1. Avatar for xkcd 11. xkcd 5 pts. 9,007
  2. Avatar for Deleted group 12. Deleted group pts. 8,921
  3. Avatar for Natural Abilities 13. Natural Abilities 2 pts. 8,827
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 2 pts. 8,718
  5. Avatar for GC Sommerlejr 2017 15. GC Sommerlejr 2017 1 pt. 8,663
  6. Avatar for FoldIt@Netherlands 16. FoldIt@Netherlands 1 pt. 8,412
  7. Avatar for Deleted group 17. Deleted group pts. 8,385
  8. Avatar for :) 18. :) 1 pt. 8,197
  9. Avatar for Boinformatics and biotechnology course 19. Boinformatics and biotechnology course 1 pt. 8,178
  10. Avatar for SETI.Germany 20. SETI.Germany 1 pt. 7,803
  1. Avatar for toshiue 91. toshiue Lv 1 3 pts. 8,708
  2. Avatar for dbuske 92. dbuske Lv 1 3 pts. 8,708
  3. Avatar for mitarcher 93. mitarcher Lv 1 3 pts. 8,671
  4. Avatar for ZAxel91 94. ZAxel91 Lv 1 3 pts. 8,666
  5. Avatar for DrCompchem 95. DrCompchem Lv 1 3 pts. 8,663
  6. Avatar for ppp6 96. ppp6 Lv 1 2 pts. 8,651
  7. Avatar for spritz1992 97. spritz1992 Lv 1 2 pts. 8,639
  8. Avatar for Anton Trikshev 98. Anton Trikshev Lv 1 2 pts. 8,629
  9. Avatar for Arne Heessels 99. Arne Heessels Lv 1 2 pts. 8,626
  10. Avatar for Superphosphate 100. Superphosphate Lv 1 2 pts. 8,619

Comments