Placeholder image of a protein
Icon representing a puzzle

1405: Unsolved De-novo Freestyle 111

Closed since over 8 years ago

Intermediate Overall Prediction

Summary


Created
July 18, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


HDEEERQRQLKKFKEWSKKQSNNTRMEERHHNGKRVLVIVVGDSESVIEIENGQVRSEVRSGTDEDSTRSMKELSEELRKLKDKL

Top groups


  1. Avatar for xkcd 11. xkcd 5 pts. 9,007
  2. Avatar for Deleted group 12. Deleted group pts. 8,921
  3. Avatar for Natural Abilities 13. Natural Abilities 2 pts. 8,827
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 2 pts. 8,718
  5. Avatar for GC Sommerlejr 2017 15. GC Sommerlejr 2017 1 pt. 8,663
  6. Avatar for FoldIt@Netherlands 16. FoldIt@Netherlands 1 pt. 8,412
  7. Avatar for Deleted group 17. Deleted group pts. 8,385
  8. Avatar for :) 18. :) 1 pt. 8,197
  9. Avatar for SETI.Germany 20. SETI.Germany 1 pt. 7,803

  1. Avatar for doctaven 131. doctaven Lv 1 1 pt. 7,648
  2. Avatar for Christy_b 132. Christy_b Lv 1 1 pt. 7,613
  3. Avatar for andylin1669103174 133. andylin1669103174 Lv 1 1 pt. 7,602
  4. Avatar for Donald_H 134. Donald_H Lv 1 1 pt. 7,530
  5. Avatar for nesmeth 135. nesmeth Lv 1 1 pt. 7,489
  6. Avatar for arlettelh97 136. arlettelh97 Lv 1 1 pt. 7,482
  7. Avatar for LicketySplit1492 137. LicketySplit1492 Lv 1 1 pt. 7,476
  8. Avatar for mydraketo 138. mydraketo Lv 1 1 pt. 7,456
  9. Avatar for quokka 139. quokka Lv 1 1 pt. 7,454
  10. Avatar for ukpc5 140. ukpc5 Lv 1 1 pt. 7,416

Comments