Placeholder image of a protein
Icon representing a puzzle

1405: Unsolved De-novo Freestyle 111

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
July 18, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


HDEEERQRQLKKFKEWSKKQSNNTRMEERHHNGKRVLVIVVGDSESVIEIENGQVRSEVRSGTDEDSTRSMKELSEELRKLKDKL

Top groups

  1. Avatar for xkcd 11. xkcd 5 pts. 9,007
  2. Avatar for Deleted group 12. Deleted group pts. 8,921
  3. Avatar for Natural Abilities 13. Natural Abilities 2 pts. 8,827
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 2 pts. 8,718
  5. Avatar for GC Sommerlejr 2017 15. GC Sommerlejr 2017 1 pt. 8,663
  6. Avatar for FoldIt@Netherlands 16. FoldIt@Netherlands 1 pt. 8,412
  7. Avatar for Deleted group 17. Deleted group pts. 8,385
  8. Avatar for :) 18. :) 1 pt. 8,197
  9. Avatar for Boinformatics and biotechnology course 19. Boinformatics and biotechnology course 1 pt. 8,178
  10. Avatar for SETI.Germany 20. SETI.Germany 1 pt. 7,803
  1. Avatar for Ciruxia 141. Ciruxia Lv 1 1 pt. 7,406
  2. Avatar for zxlitening 142. zxlitening Lv 1 1 pt. 7,336
  3. Avatar for nemesis21 143. nemesis21 Lv 1 1 pt. 7,153
  4. Avatar for andrewxc 144. andrewxc Lv 1 1 pt. 6,825
  5. Avatar for FoolontheHill24 145. FoolontheHill24 Lv 1 1 pt. 6,820
  6. Avatar for Mackenzie_BestL 146. Mackenzie_BestL Lv 1 1 pt. 6,764
  7. Avatar for Biomolecularchemist_Danny9292 147. Biomolecularchemist_Danny9292 Lv 1 1 pt. 6,668
  8. Avatar for lamoille 148. lamoille Lv 1 1 pt. 6,557
  9. Avatar for Fog Darts 149. Fog Darts Lv 1 1 pt. 6,376
  10. Avatar for pandapharmd 150. pandapharmd Lv 1 1 pt. 5,994

Comments