Placeholder image of a protein
Icon representing a puzzle

1405: Unsolved De-novo Freestyle 111

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
July 18, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


HDEEERQRQLKKFKEWSKKQSNNTRMEERHHNGKRVLVIVVGDSESVIEIENGQVRSEVRSGTDEDSTRSMKELSEELRKLKDKL

Top groups

  1. Avatar for xkcd 11. xkcd 5 pts. 9,007
  2. Avatar for Deleted group 12. Deleted group pts. 8,921
  3. Avatar for Natural Abilities 13. Natural Abilities 2 pts. 8,827
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 2 pts. 8,718
  5. Avatar for GC Sommerlejr 2017 15. GC Sommerlejr 2017 1 pt. 8,663
  6. Avatar for FoldIt@Netherlands 16. FoldIt@Netherlands 1 pt. 8,412
  7. Avatar for Deleted group 17. Deleted group pts. 8,385
  8. Avatar for :) 18. :) 1 pt. 8,197
  9. Avatar for Boinformatics and biotechnology course 19. Boinformatics and biotechnology course 1 pt. 8,178
  10. Avatar for SETI.Germany 20. SETI.Germany 1 pt. 7,803
  1. Avatar for shuuji517 161. shuuji517 Lv 1 1 pt. 268
  2. Avatar for Tehnologik1 162. Tehnologik1 Lv 1 1 pt. 0
  3. Avatar for metafolder 163. metafolder Lv 1 1 pt. 0
  4. Avatar for brucederby 164. brucederby Lv 1 1 pt. 0
  5. Avatar for Vincenzo Brancaccio 165. Vincenzo Brancaccio Lv 1 1 pt. 0
  6. Avatar for Ikuso 166. Ikuso Lv 1 1 pt. 0
  7. Avatar for hpaege 167. hpaege Lv 1 1 pt. 0
  8. Avatar for tony46 168. tony46 Lv 1 1 pt. 0
  9. Avatar for einstien123 169. einstien123 Lv 1 1 pt. 0
  10. Avatar for Avi.kawa 170. Avi.kawa Lv 1 1 pt. 0

Comments