Placeholder image of a protein
Icon representing a puzzle

1405: Unsolved De-novo Freestyle 111

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
July 18, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


HDEEERQRQLKKFKEWSKKQSNNTRMEERHHNGKRVLVIVVGDSESVIEIENGQVRSEVRSGTDEDSTRSMKELSEELRKLKDKL

Top groups

  1. Avatar for Team South Africa 21. Team South Africa 1 pt. 7,648
  2. Avatar for Kotocycle 22. Kotocycle 1 pt. 0
  3. Avatar for DNA Masters 23. DNA Masters 1 pt. 0
  1. Avatar for tokens
    1. tokens Lv 1
    100 pts. 9,662
  2. Avatar for markm457 2. markm457 Lv 1 98 pts. 9,641
  3. Avatar for actiasluna 3. actiasluna Lv 1 95 pts. 9,636
  4. Avatar for Deleted player 4. Deleted player pts. 9,628
  5. Avatar for Galaxie 5. Galaxie Lv 1 90 pts. 9,602
  6. Avatar for Skippysk8s 6. Skippysk8s Lv 1 87 pts. 9,574
  7. Avatar for bertro 7. bertro Lv 1 84 pts. 9,571
  8. Avatar for Susume 8. Susume Lv 1 82 pts. 9,523
  9. Avatar for fiendish_ghoul 9. fiendish_ghoul Lv 1 80 pts. 9,522
  10. Avatar for hansvandenhof 10. hansvandenhof Lv 1 77 pts. 9,500

Comments