Placeholder image of a protein
Icon representing a puzzle

1405: Unsolved De-novo Freestyle 111

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
July 18, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


HDEEERQRQLKKFKEWSKKQSNNTRMEERHHNGKRVLVIVVGDSESVIEIENGQVRSEVRSGTDEDSTRSMKELSEELRKLKDKL

Top groups

  1. Avatar for Team South Africa 21. Team South Africa 1 pt. 7,648
  2. Avatar for Kotocycle 22. Kotocycle 1 pt. 0
  3. Avatar for DNA Masters 23. DNA Masters 1 pt. 0
  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 9,685
  2. Avatar for Deleted player 2. Deleted player pts. 9,673
  3. Avatar for lamoille 3. lamoille Lv 1 71 pts. 9,668
  4. Avatar for gmn 4. gmn Lv 1 60 pts. 9,658
  5. Avatar for phi16 5. phi16 Lv 1 49 pts. 9,657
  6. Avatar for actiasluna 6. actiasluna Lv 1 41 pts. 9,656
  7. Avatar for Skippysk8s 7. Skippysk8s Lv 1 33 pts. 9,655
  8. Avatar for Blipperman 8. Blipperman Lv 1 27 pts. 9,653
  9. Avatar for alwen 9. alwen Lv 1 22 pts. 9,572
  10. Avatar for LociOiling 10. LociOiling Lv 1 17 pts. 9,572

Comments