Placeholder image of a protein
Icon representing a puzzle

1405: Unsolved De-novo Freestyle 111

Closed since almost 9 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
July 18, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


HDEEERQRQLKKFKEWSKKQSNNTRMEERHHNGKRVLVIVVGDSESVIEIENGQVRSEVRSGTDEDSTRSMKELSEELRKLKDKL

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,685
  2. Avatar for Gargleblasters 2. Gargleblasters 80 pts. 9,656
  3. Avatar for Beta Folders 3. Beta Folders 63 pts. 9,572
  4. Avatar for Marvin's bunch 4. Marvin's bunch 49 pts. 9,465
  5. Avatar for Contenders 5. Contenders 37 pts. 9,464
  6. Avatar for Go Science 6. Go Science 28 pts. 9,463
  7. Avatar for Void Crushers 7. Void Crushers 21 pts. 9,293
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 15 pts. 9,278
  9. Avatar for Russian team 9. Russian team 11 pts. 9,104
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 8 pts. 9,022

  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 9,685
  2. Avatar for Deleted player 2. Deleted player pts. 9,673
  3. Avatar for lamoille 3. lamoille Lv 1 71 pts. 9,668
  4. Avatar for gmn 4. gmn Lv 1 60 pts. 9,658
  5. Avatar for phi16 5. phi16 Lv 1 49 pts. 9,657
  6. Avatar for actiasluna 6. actiasluna Lv 1 41 pts. 9,656
  7. Avatar for Skippysk8s 7. Skippysk8s Lv 1 33 pts. 9,655
  8. Avatar for Blipperman 8. Blipperman Lv 1 27 pts. 9,653
  9. Avatar for alwen 9. alwen Lv 1 22 pts. 9,572
  10. Avatar for LociOiling 10. LociOiling Lv 1 17 pts. 9,572

Comments