Placeholder image of a protein
Icon representing a puzzle

1409: Revisiting Puzzle 135: E. coli

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
July 27, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 3 pts. 8,606
  2. Avatar for Kotocycle 12. Kotocycle 2 pts. 8,583
  3. Avatar for Russian team 13. Russian team 1 pt. 8,572
  4. Avatar for Piratenpartei Deutschland 14. Piratenpartei Deutschland 1 pt. 8,501
  5. Avatar for Natural Abilities 15. Natural Abilities 1 pt. 8,453
  6. Avatar for xkcd 16. xkcd 1 pt. 8,429
  7. Avatar for :) 17. :) 1 pt. 7,865
  8. Avatar for FoldIt@Netherlands 18. FoldIt@Netherlands 1 pt. 7,317
  9. Avatar for DSN @ Home 19. DSN @ Home 1 pt. 6,804
  10. Avatar for BOINC@Poland 20. BOINC@Poland 1 pt. 5,999
  1. Avatar for markm457
    1. markm457 Lv 1
    100 pts. 8,925
  2. Avatar for LociOiling 2. LociOiling Lv 1 97 pts. 8,922
  3. Avatar for retiredmichael 3. retiredmichael Lv 1 94 pts. 8,919
  4. Avatar for eusair 4. eusair Lv 1 91 pts. 8,915
  5. Avatar for gmn 5. gmn Lv 1 88 pts. 8,912
  6. Avatar for ZeroLeak7 6. ZeroLeak7 Lv 1 85 pts. 8,906
  7. Avatar for fiendish_ghoul 7. fiendish_ghoul Lv 1 82 pts. 8,895
  8. Avatar for gitwut 8. gitwut Lv 1 79 pts. 8,889
  9. Avatar for mimi 9. mimi Lv 1 77 pts. 8,884
  10. Avatar for crpainter 10. crpainter Lv 1 74 pts. 8,877

Comments